Anti OSR2 pAb (ATL-HPA052425)

Atlas Antibodies

Catalog No.:
ATL-HPA052425-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: odd-skipped related transciption factor 2
Gene Name: OSR2
Alternative Gene Name: FLJ90037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022330: 96%, ENSRNOG00000011136: 99%
Entrez Gene ID: 116039
Uniprot ID: Q8N2R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TMHMNHWTLGYPNVHEITRSTITEMAAAQGLVDARFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFANL
Gene Sequence TMHMNHWTLGYPNVHEITRSTITEMAAAQGLVDARFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFANL
Gene ID - Mouse ENSMUSG00000022330
Gene ID - Rat ENSRNOG00000011136
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OSR2 pAb (ATL-HPA052425)
Datasheet Anti OSR2 pAb (ATL-HPA052425) Datasheet (External Link)
Vendor Page Anti OSR2 pAb (ATL-HPA052425) at Atlas Antibodies

Documents & Links for Anti OSR2 pAb (ATL-HPA052425)
Datasheet Anti OSR2 pAb (ATL-HPA052425) Datasheet (External Link)
Vendor Page Anti OSR2 pAb (ATL-HPA052425)