Anti OSGIN2 pAb (ATL-HPA050595)

Atlas Antibodies

Catalog No.:
ATL-HPA050595-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: oxidative stress induced growth inhibitor family member 2
Gene Name: OSGIN2
Alternative Gene Name: C8orf1, hT41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041153: 91%, ENSRNOG00000009358: 91%
Entrez Gene ID: 734
Uniprot ID: Q9Y236
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGSMLTISFGSWMELPGLKFKDWVSSKRRSLKGDRVMPEEIARYYKHYVKVMGLQKNFRENTYITSVSRLYRDQDDDDIQDRDISTKHLQ
Gene Sequence EGSMLTISFGSWMELPGLKFKDWVSSKRRSLKGDRVMPEEIARYYKHYVKVMGLQKNFRENTYITSVSRLYRDQDDDDIQDRDISTKHLQ
Gene ID - Mouse ENSMUSG00000041153
Gene ID - Rat ENSRNOG00000009358
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OSGIN2 pAb (ATL-HPA050595)
Datasheet Anti OSGIN2 pAb (ATL-HPA050595) Datasheet (External Link)
Vendor Page Anti OSGIN2 pAb (ATL-HPA050595) at Atlas Antibodies

Documents & Links for Anti OSGIN2 pAb (ATL-HPA050595)
Datasheet Anti OSGIN2 pAb (ATL-HPA050595) Datasheet (External Link)
Vendor Page Anti OSGIN2 pAb (ATL-HPA050595)