Anti OSGIN2 pAb (ATL-HPA028515)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028515-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: OSGIN2
Alternative Gene Name: C8orf1, hT41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041153: 93%, ENSRNOG00000009358: 90%
Entrez Gene ID: 734
Uniprot ID: Q9Y236
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SNFIKRNWEIRGYQRIADGSHVPFCLFAENVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGKVDPVLIVGSG |
| Gene Sequence | SNFIKRNWEIRGYQRIADGSHVPFCLFAENVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGKVDPVLIVGSG |
| Gene ID - Mouse | ENSMUSG00000041153 |
| Gene ID - Rat | ENSRNOG00000009358 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OSGIN2 pAb (ATL-HPA028515) | |
| Datasheet | Anti OSGIN2 pAb (ATL-HPA028515) Datasheet (External Link) |
| Vendor Page | Anti OSGIN2 pAb (ATL-HPA028515) at Atlas Antibodies |
| Documents & Links for Anti OSGIN2 pAb (ATL-HPA028515) | |
| Datasheet | Anti OSGIN2 pAb (ATL-HPA028515) Datasheet (External Link) |
| Vendor Page | Anti OSGIN2 pAb (ATL-HPA028515) |