Anti OSCAR pAb (ATL-HPA073996)

Atlas Antibodies

Catalog No.:
ATL-HPA073996-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: osteoclast associated, immunoglobulin-like receptor
Gene Name: OSCAR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054594: 73%, ENSRNOG00000055716: 68%
Entrez Gene ID: 126014
Uniprot ID: Q8IYS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYH
Gene Sequence VGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYH
Gene ID - Mouse ENSMUSG00000054594
Gene ID - Rat ENSRNOG00000055716
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OSCAR pAb (ATL-HPA073996)
Datasheet Anti OSCAR pAb (ATL-HPA073996) Datasheet (External Link)
Vendor Page Anti OSCAR pAb (ATL-HPA073996) at Atlas Antibodies

Documents & Links for Anti OSCAR pAb (ATL-HPA073996)
Datasheet Anti OSCAR pAb (ATL-HPA073996) Datasheet (External Link)
Vendor Page Anti OSCAR pAb (ATL-HPA073996)