Anti OSBPL7 pAb (ATL-HPA073967)

Atlas Antibodies

SKU:
ATL-HPA073967-25
  • Immunofluorescent staining of human cell line HaCaT shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: oxysterol binding protein like 7
Gene Name: OSBPL7
Alternative Gene Name: MGC71150, ORP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038534: 94%, ENSRNOG00000009473: 95%
Entrez Gene ID: 114881
Uniprot ID: Q9BZF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESLHRIPSAPVIPTHQASVTTERPKKGKRTSRMWCTQSFAKDDTIGRVGRLHGSVPNLSRYLESRDSSGTRGLPPTDYAHLQRSFWALAQKVHSSL
Gene Sequence ESLHRIPSAPVIPTHQASVTTERPKKGKRTSRMWCTQSFAKDDTIGRVGRLHGSVPNLSRYLESRDSSGTRGLPPTDYAHLQRSFWALAQKVHSSL
Gene ID - Mouse ENSMUSG00000038534
Gene ID - Rat ENSRNOG00000009473
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti OSBPL7 pAb (ATL-HPA073967)
Datasheet Anti OSBPL7 pAb (ATL-HPA073967) Datasheet (External Link)
Vendor Page Anti OSBPL7 pAb (ATL-HPA073967) at Atlas Antibodies

Documents & Links for Anti OSBPL7 pAb (ATL-HPA073967)
Datasheet Anti OSBPL7 pAb (ATL-HPA073967) Datasheet (External Link)
Vendor Page Anti OSBPL7 pAb (ATL-HPA073967)