Anti OSBPL5 pAb (ATL-HPA038335)

Atlas Antibodies

Catalog No.: ATL-HPA038335-25

Protein Description: oxysterol binding protein-like 5
Gene Name: OSBPL5
Alternative Gene Name: KIAA1534, ORP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037606: 80%, ENSRNOG00000020713: 80%
Entrez Gene ID: 114879
Uniprot ID: Q9H0X9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LCGLPASATVHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEEL
• Gene Sequence: LCGLPASATVHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEEL
• Gene ID - Mouse: ENSMUSG00000037606
• Gene ID - Rat: ENSRNOG00000020713
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OSBPL5 pAb (ATL-HPA038335) – 2 Found

Du, Ximing; Zadoorian, Armella; Lukmantara, Ivan E; Qi, Yanfei; Brown, Andrew J; Yang, Hongyuan. Oxysterol-binding protein-related protein 5 (ORP5) promotes cell proliferation by activation of mTORC1 signaling. The Journal Of Biological Chemistry. 2018;293(10):3806-3818. 

Du, Ximing; Zhou, Linkang; Aw, Yvette Celine; Mak, Hoi Yin; Xu, Yanqing; Rae, James; Wang, Wenmin; Zadoorian, Armella; Hancock, Sarah E; Osborne, Brenna; Chen, Xiang; Wu, Jia-Wei; Turner, Nigel; Parton, Robert G; Li, Peng; Yang, Hongyuan. ORP5 localizes to ER-lipid droplet contacts and regulates the level of PI(4)P on lipid droplets. The Journal Of Cell Biology. 2020;219(1)