Anti ORC6 pAb (ATL-HPA072587)

Atlas Antibodies

Catalog No.: ATL-HPA072587-25

Protein Description: origin recognition complex, subunit 6
Gene Name: ORC6
Alternative Gene Name: ORC6L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031697: 61%, ENSRNOG00000024043: 54%
Entrez Gene ID: 23594
Uniprot ID: Q9Y5N6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQ
• Gene Sequence: RLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQ
• Gene ID - Mouse: ENSMUSG00000031697
• Gene ID - Rat: ENSRNOG00000024043
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.