Anti ORC6 pAb (ATL-HPA072587)

Atlas Antibodies

Catalog No.:
ATL-HPA072587-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: origin recognition complex, subunit 6
Gene Name: ORC6
Alternative Gene Name: ORC6L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031697: 61%, ENSRNOG00000024043: 54%
Entrez Gene ID: 23594
Uniprot ID: Q9Y5N6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQ
Gene Sequence RLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQ
Gene ID - Mouse ENSMUSG00000031697
Gene ID - Rat ENSRNOG00000024043
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ORC6 pAb (ATL-HPA072587)
Datasheet Anti ORC6 pAb (ATL-HPA072587) Datasheet (External Link)
Vendor Page Anti ORC6 pAb (ATL-HPA072587) at Atlas Antibodies

Documents & Links for Anti ORC6 pAb (ATL-HPA072587)
Datasheet Anti ORC6 pAb (ATL-HPA072587) Datasheet (External Link)
Vendor Page Anti ORC6 pAb (ATL-HPA072587)