Anti ORC5 pAb (ATL-HPA019730)

Atlas Antibodies

Catalog No.: ATL-HPA019730-25

Protein Description: origin recognition complex, subunit 5
Gene Name: ORC5
Alternative Gene Name: ORC5L, Orc5p, ORC5T, PPP1R117
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029012: 94%, ENSRNOG00000011519: 92%
Entrez Gene ID: 5001
Uniprot ID: O43913
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAA
• Gene Sequence: GEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAA
• Gene ID - Mouse: ENSMUSG00000029012
• Gene ID - Rat: ENSRNOG00000011519
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.