Anti ORC4 pAb (ATL-HPA064562)

Atlas Antibodies

Catalog No.:
ATL-HPA064562-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: origin recognition complex, subunit 4
Gene Name: ORC4
Alternative Gene Name: HsORC4, ORC4L, Orc4p
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 5000
Uniprot ID: O43929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHL
Gene Sequence SRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHL
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ORC4 pAb (ATL-HPA064562)
Datasheet Anti ORC4 pAb (ATL-HPA064562) Datasheet (External Link)
Vendor Page Anti ORC4 pAb (ATL-HPA064562) at Atlas Antibodies

Documents & Links for Anti ORC4 pAb (ATL-HPA064562)
Datasheet Anti ORC4 pAb (ATL-HPA064562) Datasheet (External Link)
Vendor Page Anti ORC4 pAb (ATL-HPA064562)