Anti ORC2 pAb (ATL-HPA073881)

Atlas Antibodies

Catalog No.:
ATL-HPA073881-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: origin recognition complex, subunit 2
Gene Name: ORC2
Alternative Gene Name: ORC2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026037: 69%, ENSRNOG00000012558: 70%
Entrez Gene ID: 4999
Uniprot ID: Q13416
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAK
Gene Sequence MLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAK
Gene ID - Mouse ENSMUSG00000026037
Gene ID - Rat ENSRNOG00000012558
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ORC2 pAb (ATL-HPA073881)
Datasheet Anti ORC2 pAb (ATL-HPA073881) Datasheet (External Link)
Vendor Page Anti ORC2 pAb (ATL-HPA073881) at Atlas Antibodies

Documents & Links for Anti ORC2 pAb (ATL-HPA073881)
Datasheet Anti ORC2 pAb (ATL-HPA073881) Datasheet (External Link)
Vendor Page Anti ORC2 pAb (ATL-HPA073881)