Anti ORC2 pAb (ATL-HPA073881)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073881-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ORC2
Alternative Gene Name: ORC2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026037: 69%, ENSRNOG00000012558: 70%
Entrez Gene ID: 4999
Uniprot ID: Q13416
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAK |
| Gene Sequence | MLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAK |
| Gene ID - Mouse | ENSMUSG00000026037 |
| Gene ID - Rat | ENSRNOG00000012558 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ORC2 pAb (ATL-HPA073881) | |
| Datasheet | Anti ORC2 pAb (ATL-HPA073881) Datasheet (External Link) |
| Vendor Page | Anti ORC2 pAb (ATL-HPA073881) at Atlas Antibodies |
| Documents & Links for Anti ORC2 pAb (ATL-HPA073881) | |
| Datasheet | Anti ORC2 pAb (ATL-HPA073881) Datasheet (External Link) |
| Vendor Page | Anti ORC2 pAb (ATL-HPA073881) |