Anti ORC1 pAb (ATL-HPA027439)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027439-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ORC1
Alternative Gene Name: HSORC1, ORC1L, PARC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028587: 96%, ENSRNOG00000008841: 96%
Entrez Gene ID: 4998
Uniprot ID: Q13415
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYA |
| Gene Sequence | LEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYA |
| Gene ID - Mouse | ENSMUSG00000028587 |
| Gene ID - Rat | ENSRNOG00000008841 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ORC1 pAb (ATL-HPA027439) | |
| Datasheet | Anti ORC1 pAb (ATL-HPA027439) Datasheet (External Link) |
| Vendor Page | Anti ORC1 pAb (ATL-HPA027439) at Atlas Antibodies |
| Documents & Links for Anti ORC1 pAb (ATL-HPA027439) | |
| Datasheet | Anti ORC1 pAb (ATL-HPA027439) Datasheet (External Link) |
| Vendor Page | Anti ORC1 pAb (ATL-HPA027439) |