Anti ORAOV1 pAb (ATL-HPA062696)

Atlas Antibodies

Catalog No.:
ATL-HPA062696-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: oral cancer overexpressed 1
Gene Name: ORAOV1
Alternative Gene Name: TAOS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031072: 75%, ENSRNOG00000020903: 75%
Entrez Gene ID: 220064
Uniprot ID: Q8WV07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF
Gene Sequence GMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF
Gene ID - Mouse ENSMUSG00000031072
Gene ID - Rat ENSRNOG00000020903
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ORAOV1 pAb (ATL-HPA062696)
Datasheet Anti ORAOV1 pAb (ATL-HPA062696) Datasheet (External Link)
Vendor Page Anti ORAOV1 pAb (ATL-HPA062696) at Atlas Antibodies

Documents & Links for Anti ORAOV1 pAb (ATL-HPA062696)
Datasheet Anti ORAOV1 pAb (ATL-HPA062696) Datasheet (External Link)
Vendor Page Anti ORAOV1 pAb (ATL-HPA062696)