Anti ORAI2 pAb (ATL-HPA055137)

Atlas Antibodies

Catalog No.: ATL-HPA055137-25

Protein Description: ORAI calcium release-activated calcium modulator 2
Gene Name: ORAI2
Alternative Gene Name: C7orf19, CBCIP2, FLJ12474, FLJ14733, H_NH0514P08.8, TMEM142B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039747: 98%, ENSRNOG00000001427: 98%
Entrez Gene ID: 80228
Uniprot ID: Q96SN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSW
• Gene Sequence: MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSW
• Gene ID - Mouse: ENSMUSG00000039747
• Gene ID - Rat: ENSRNOG00000001427
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ORAI2 pAb (ATL-HPA055137) – 1 Found

Yao, Ciyu; Ye, Wenzhen; Chen, Mengxue. Inhibition of Mast Cell Degranulation in Atopic Dermatitis by Celastrol through Suppressing MRGPRX2. Disease Markers. 2023( 36712922):9049256.