Anti ORAI2 pAb (ATL-HPA055137)

Atlas Antibodies

Catalog No.:
ATL-HPA055137-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ORAI calcium release-activated calcium modulator 2
Gene Name: ORAI2
Alternative Gene Name: C7orf19, CBCIP2, FLJ12474, FLJ14733, H_NH0514P08.8, TMEM142B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039747: 98%, ENSRNOG00000001427: 98%
Entrez Gene ID: 80228
Uniprot ID: Q96SN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSW
Gene Sequence MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSW
Gene ID - Mouse ENSMUSG00000039747
Gene ID - Rat ENSRNOG00000001427
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ORAI2 pAb (ATL-HPA055137)
Datasheet Anti ORAI2 pAb (ATL-HPA055137) Datasheet (External Link)
Vendor Page Anti ORAI2 pAb (ATL-HPA055137) at Atlas Antibodies

Documents & Links for Anti ORAI2 pAb (ATL-HPA055137)
Datasheet Anti ORAI2 pAb (ATL-HPA055137) Datasheet (External Link)
Vendor Page Anti ORAI2 pAb (ATL-HPA055137)
Citations for Anti ORAI2 pAb (ATL-HPA055137) – 1 Found
Yao, Ciyu; Ye, Wenzhen; Chen, Mengxue. Inhibition of Mast Cell Degranulation in Atopic Dermatitis by Celastrol through Suppressing MRGPRX2. Disease Markers. 2023( 36712922):9049256.  PubMed