Anti ORAI1 pAb (ATL-HPA061823)

Atlas Antibodies

Catalog No.: ATL-HPA061823-25

Protein Description: ORAI calcium release-activated calcium modulator 1
Gene Name: ORAI1
Alternative Gene Name: CRACM1, FLJ14466, TMEM142A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049686: 64%, ENSRNOG00000001336: 57%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQA
• Gene Sequence: VKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQA
• Gene ID - Mouse: ENSMUSG00000049686
• Gene ID - Rat: ENSRNOG00000001336
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.