Anti ORAI1 pAb (ATL-HPA061823)

Atlas Antibodies

Catalog No.:
ATL-HPA061823-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ORAI calcium release-activated calcium modulator 1
Gene Name: ORAI1
Alternative Gene Name: CRACM1, FLJ14466, TMEM142A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049686: 64%, ENSRNOG00000001336: 57%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQA
Gene Sequence VKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQA
Gene ID - Mouse ENSMUSG00000049686
Gene ID - Rat ENSRNOG00000001336
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ORAI1 pAb (ATL-HPA061823)
Datasheet Anti ORAI1 pAb (ATL-HPA061823) Datasheet (External Link)
Vendor Page Anti ORAI1 pAb (ATL-HPA061823) at Atlas Antibodies

Documents & Links for Anti ORAI1 pAb (ATL-HPA061823)
Datasheet Anti ORAI1 pAb (ATL-HPA061823) Datasheet (External Link)
Vendor Page Anti ORAI1 pAb (ATL-HPA061823)