Anti ORAI1 pAb (ATL-HPA061823)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061823-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ORAI1
Alternative Gene Name: CRACM1, FLJ14466, TMEM142A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049686: 64%, ENSRNOG00000001336: 57%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQA |
| Gene Sequence | VKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQA |
| Gene ID - Mouse | ENSMUSG00000049686 |
| Gene ID - Rat | ENSRNOG00000001336 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ORAI1 pAb (ATL-HPA061823) | |
| Datasheet | Anti ORAI1 pAb (ATL-HPA061823) Datasheet (External Link) |
| Vendor Page | Anti ORAI1 pAb (ATL-HPA061823) at Atlas Antibodies |
| Documents & Links for Anti ORAI1 pAb (ATL-HPA061823) | |
| Datasheet | Anti ORAI1 pAb (ATL-HPA061823) Datasheet (External Link) |
| Vendor Page | Anti ORAI1 pAb (ATL-HPA061823) |