Anti OR4K1 pAb (ATL-HPA028877)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028877-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: OR4K1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050030: 88%, ENSRNOG00000047060: 68%
Entrez Gene ID: 79544
Uniprot ID: Q8NGD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TVDLPFCGPNEVDSFFCDLPLVIELACMDTYEMEIMTLTN |
| Gene Sequence | TVDLPFCGPNEVDSFFCDLPLVIELACMDTYEMEIMTLTN |
| Gene ID - Mouse | ENSMUSG00000050030 |
| Gene ID - Rat | ENSRNOG00000047060 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OR4K1 pAb (ATL-HPA028877) | |
| Datasheet | Anti OR4K1 pAb (ATL-HPA028877) Datasheet (External Link) |
| Vendor Page | Anti OR4K1 pAb (ATL-HPA028877) at Atlas Antibodies |
| Documents & Links for Anti OR4K1 pAb (ATL-HPA028877) | |
| Datasheet | Anti OR4K1 pAb (ATL-HPA028877) Datasheet (External Link) |
| Vendor Page | Anti OR4K1 pAb (ATL-HPA028877) |