Anti OR4K1 pAb (ATL-HPA028877)

Atlas Antibodies

Catalog No.: ATL-HPA028877-25

Protein Description: olfactory receptor, family 4, subfamily K, member 1
Gene Name: OR4K1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050030: 88%, ENSRNOG00000047060: 68%
Entrez Gene ID: 79544
Uniprot ID: Q8NGD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVDLPFCGPNEVDSFFCDLPLVIELACMDTYEMEIMTLTN
• Gene Sequence: TVDLPFCGPNEVDSFFCDLPLVIELACMDTYEMEIMTLTN
• Gene ID - Mouse: ENSMUSG00000050030
• Gene ID - Rat: ENSRNOG00000047060
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.