Anti OR4C5 pAb (ATL-HPA049516)

Atlas Antibodies

Catalog No.: ATL-HPA049516-25

Protein Description: olfactory receptor, family 4, subfamily C, member 5 (gene/pseudogene)
Gene Name: OR4C5
Alternative Gene Name: OR4C5P, OR4C5Q
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018796: 34%, ENSRNOG00000010633: 37%
Entrez Gene ID: 79346
Uniprot ID: Q8NGB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MYVSNCNPCAIHRKINYPNTKLDFEQVNNITEFIL
• Gene Sequence: MYVSNCNPCAIHRKINYPNTKLDFEQVNNITEFIL
• Gene ID - Mouse: ENSMUSG00000018796
• Gene ID - Rat: ENSRNOG00000010633
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.