Anti OR4C5 pAb (ATL-HPA049516)

Atlas Antibodies

Catalog No.:
ATL-HPA049516-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: olfactory receptor, family 4, subfamily C, member 5 (gene/pseudogene)
Gene Name: OR4C5
Alternative Gene Name: OR4C5P, OR4C5Q
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018796: 34%, ENSRNOG00000010633: 37%
Entrez Gene ID: 79346
Uniprot ID: Q8NGB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MYVSNCNPCAIHRKINYPNTKLDFEQVNNITEFIL
Gene Sequence MYVSNCNPCAIHRKINYPNTKLDFEQVNNITEFIL
Gene ID - Mouse ENSMUSG00000018796
Gene ID - Rat ENSRNOG00000010633
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OR4C5 pAb (ATL-HPA049516)
Datasheet Anti OR4C5 pAb (ATL-HPA049516) Datasheet (External Link)
Vendor Page Anti OR4C5 pAb (ATL-HPA049516) at Atlas Antibodies

Documents & Links for Anti OR4C5 pAb (ATL-HPA049516)
Datasheet Anti OR4C5 pAb (ATL-HPA049516) Datasheet (External Link)
Vendor Page Anti OR4C5 pAb (ATL-HPA049516)