Anti OR2T1 pAb (ATL-HPA063064)
Atlas Antibodies
- SKU:
- ATL-HPA063064-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: OR2T1
Alternative Gene Name: OR1-25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072707: 43%, ENSRNOG00000006734: 48%
Entrez Gene ID: 26696
Uniprot ID: O43869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PWECYHLIWKILPYIGTTVGSMEEYNTSSTDFTFMGLFNRKETS |
Gene Sequence | PWECYHLIWKILPYIGTTVGSMEEYNTSSTDFTFMGLFNRKETS |
Gene ID - Mouse | ENSMUSG00000072707 |
Gene ID - Rat | ENSRNOG00000006734 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti OR2T1 pAb (ATL-HPA063064) | |
Datasheet | Anti OR2T1 pAb (ATL-HPA063064) Datasheet (External Link) |
Vendor Page | Anti OR2T1 pAb (ATL-HPA063064) at Atlas Antibodies |
Documents & Links for Anti OR2T1 pAb (ATL-HPA063064) | |
Datasheet | Anti OR2T1 pAb (ATL-HPA063064) Datasheet (External Link) |
Vendor Page | Anti OR2T1 pAb (ATL-HPA063064) |