Anti OR2T1 pAb (ATL-HPA063064)

Atlas Antibodies

Catalog No.: ATL-HPA063064-25

Protein Description: olfactory receptor, family 2, subfamily T, member 1
Gene Name: OR2T1
Alternative Gene Name: OR1-25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072707: 43%, ENSRNOG00000006734: 48%
Entrez Gene ID: 26696
Uniprot ID: O43869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PWECYHLIWKILPYIGTTVGSMEEYNTSSTDFTFMGLFNRKETS
• Gene Sequence: PWECYHLIWKILPYIGTTVGSMEEYNTSSTDFTFMGLFNRKETS
• Gene ID - Mouse: ENSMUSG00000072707
• Gene ID - Rat: ENSRNOG00000006734
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.