Anti OR2T1 pAb (ATL-HPA063064)

Atlas Antibodies

Catalog No.:
ATL-HPA063064-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: olfactory receptor, family 2, subfamily T, member 1
Gene Name: OR2T1
Alternative Gene Name: OR1-25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072707: 43%, ENSRNOG00000006734: 48%
Entrez Gene ID: 26696
Uniprot ID: O43869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PWECYHLIWKILPYIGTTVGSMEEYNTSSTDFTFMGLFNRKETS
Gene Sequence PWECYHLIWKILPYIGTTVGSMEEYNTSSTDFTFMGLFNRKETS
Gene ID - Mouse ENSMUSG00000072707
Gene ID - Rat ENSRNOG00000006734
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OR2T1 pAb (ATL-HPA063064)
Datasheet Anti OR2T1 pAb (ATL-HPA063064) Datasheet (External Link)
Vendor Page Anti OR2T1 pAb (ATL-HPA063064) at Atlas Antibodies

Documents & Links for Anti OR2T1 pAb (ATL-HPA063064)
Datasheet Anti OR2T1 pAb (ATL-HPA063064) Datasheet (External Link)
Vendor Page Anti OR2T1 pAb (ATL-HPA063064)