Anti OR2K2 pAb (ATL-HPA024261)

Atlas Antibodies

Catalog No.: ATL-HPA024261-25

Protein Description: olfactory receptor, family 2, subfamily K, member 2
Gene Name: OR2K2
Alternative Gene Name: HSHTPCRH06, HTPCRH06, OR2AR1P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043385: 35%, ENSRNOG00000014263: 35%
Entrez Gene ID: 26248
Uniprot ID: Q8NGT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLYSFLYVLRLNEGNSTGRNIDERKKMQGENFTIWSIFFLEGFSQYPGLEV
• Gene Sequence: TLYSFLYVLRLNEGNSTGRNIDERKKMQGENFTIWSIFFLEGFSQYPGLEV
• Gene ID - Mouse: ENSMUSG00000043385
• Gene ID - Rat: ENSRNOG00000014263
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.