Anti OR13D1 pAb (ATL-HPA055921)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055921-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: OR13D1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033813: 33%, ENSRNOG00000001004: 31%
Entrez Gene ID: 286365
Uniprot ID: Q8NGV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ISIYLNHVLFYTTQQAGDLEHMETRNYSAMTEFFLV |
Gene Sequence | ISIYLNHVLFYTTQQAGDLEHMETRNYSAMTEFFLV |
Gene ID - Mouse | ENSMUSG00000033813 |
Gene ID - Rat | ENSRNOG00000001004 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti OR13D1 pAb (ATL-HPA055921) | |
Datasheet | Anti OR13D1 pAb (ATL-HPA055921) Datasheet (External Link) |
Vendor Page | Anti OR13D1 pAb (ATL-HPA055921) at Atlas Antibodies |
Documents & Links for Anti OR13D1 pAb (ATL-HPA055921) | |
Datasheet | Anti OR13D1 pAb (ATL-HPA055921) Datasheet (External Link) |
Vendor Page | Anti OR13D1 pAb (ATL-HPA055921) |