Anti OR10S1 pAb (ATL-HPA019038)

Atlas Antibodies

Catalog No.: ATL-HPA019038-25

Protein Description: olfactory receptor, family 10, subfamily S, member 1
Gene Name: OR10S1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049010: 41%, ENSRNOG00000058978: 41%
Entrez Gene ID: 219873
Uniprot ID: Q8NGN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTSRSVCEKMTMTTENPNQTVVSHFFLEGLRYTAKHSSL
• Gene Sequence: MTSRSVCEKMTMTTENPNQTVVSHFFLEGLRYTAKHSSL
• Gene ID - Mouse: ENSMUSG00000049010
• Gene ID - Rat: ENSRNOG00000058978
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.