Anti OPTN pAb (ATL-HPA003360 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003360-25

Protein Description: optineurin
Gene Name: OPTN
Alternative Gene Name: FIP-2, FIP2, GLC1E, HIP7, HYPL, NRP, TFIIIA-INTP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026672: 64%, ENSRNOG00000017941: 68%
Entrez Gene ID: 10133
Uniprot ID: Q96CV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKG
• Gene Sequence: LGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKG
• Gene ID - Mouse: ENSMUSG00000026672
• Gene ID - Rat: ENSRNOG00000017941
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OPTN pAb (ATL-HPA003360 w/enhanced validation) – 3 Found

Kruppa, Antonina J; Kishi-Itakura, Chieko; Masters, Thomas A; Rorbach, Joanna E; Grice, Guinevere L; Kendrick-Jones, John; Nathan, James A; Minczuk, Michal; Buss, Folma. Myosin VI-Dependent Actin Cages Encapsulate Parkin-Positive Damaged Mitochondria. Developmental Cell. 2018;44(4):484-499.e6. 

Smith, Andrew M; Sewell, Gavin W; Levine, Adam P; Chew, Thean S; Dunne, Jenny; O'Shea, Nuala R; Smith, Philip J; Harrison, Penelope J; Macdonald, Carol M; Bloom, Stuart L; Segal, Anthony W. Disruption of macrophage pro-inflammatory cytokine release in Crohn's disease is associated with reduced optineurin expression in a subset of patients. Immunology. 2015;144(1):45-55. 

O'Loughlin, Thomas; Kruppa, Antonina J; Ribeiro, Andre L R; Edgar, James R; Ghannam, Abdulaziz; Smith, Andrew M; Buss, Folma. OPTN recruitment to a Golgi-proximal compartment regulates immune signalling and cytokine secretion. Journal Of Cell Science. 2020;133(12)