Anti OPTN pAb (ATL-HPA003360 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003360-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: OPTN
Alternative Gene Name: FIP-2, FIP2, GLC1E, HIP7, HYPL, NRP, TFIIIA-INTP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026672: 64%, ENSRNOG00000017941: 68%
Entrez Gene ID: 10133
Uniprot ID: Q96CV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKG |
| Gene Sequence | LGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKG |
| Gene ID - Mouse | ENSMUSG00000026672 |
| Gene ID - Rat | ENSRNOG00000017941 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OPTN pAb (ATL-HPA003360 w/enhanced validation) | |
| Datasheet | Anti OPTN pAb (ATL-HPA003360 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OPTN pAb (ATL-HPA003360 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti OPTN pAb (ATL-HPA003360 w/enhanced validation) | |
| Datasheet | Anti OPTN pAb (ATL-HPA003360 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OPTN pAb (ATL-HPA003360 w/enhanced validation) |
| Citations for Anti OPTN pAb (ATL-HPA003360 w/enhanced validation) – 3 Found |
| Kruppa, Antonina J; Kishi-Itakura, Chieko; Masters, Thomas A; Rorbach, Joanna E; Grice, Guinevere L; Kendrick-Jones, John; Nathan, James A; Minczuk, Michal; Buss, Folma. Myosin VI-Dependent Actin Cages Encapsulate Parkin-Positive Damaged Mitochondria. Developmental Cell. 2018;44(4):484-499.e6. PubMed |
| Smith, Andrew M; Sewell, Gavin W; Levine, Adam P; Chew, Thean S; Dunne, Jenny; O'Shea, Nuala R; Smith, Philip J; Harrison, Penelope J; Macdonald, Carol M; Bloom, Stuart L; Segal, Anthony W. Disruption of macrophage pro-inflammatory cytokine release in Crohn's disease is associated with reduced optineurin expression in a subset of patients. Immunology. 2015;144(1):45-55. PubMed |
| O'Loughlin, Thomas; Kruppa, Antonina J; Ribeiro, Andre L R; Edgar, James R; Ghannam, Abdulaziz; Smith, Andrew M; Buss, Folma. OPTN recruitment to a Golgi-proximal compartment regulates immune signalling and cytokine secretion. Journal Of Cell Science. 2020;133(12) PubMed |