Anti OPRK1 pAb (ATL-HPA067549)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067549-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: OPRK1
Alternative Gene Name: KOR, OPRK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025905: 86%, ENSRNOG00000007647: 86%
Entrez Gene ID: 4986
Uniprot ID: P41145
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDGMNKPV |
| Gene Sequence | RCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDGMNKPV |
| Gene ID - Mouse | ENSMUSG00000025905 |
| Gene ID - Rat | ENSRNOG00000007647 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OPRK1 pAb (ATL-HPA067549) | |
| Datasheet | Anti OPRK1 pAb (ATL-HPA067549) Datasheet (External Link) |
| Vendor Page | Anti OPRK1 pAb (ATL-HPA067549) at Atlas Antibodies |
| Documents & Links for Anti OPRK1 pAb (ATL-HPA067549) | |
| Datasheet | Anti OPRK1 pAb (ATL-HPA067549) Datasheet (External Link) |
| Vendor Page | Anti OPRK1 pAb (ATL-HPA067549) |