Anti OPRK1 pAb (ATL-HPA067549)

Atlas Antibodies

Catalog No.:
ATL-HPA067549-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: opioid receptor kappa 1
Gene Name: OPRK1
Alternative Gene Name: KOR, OPRK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025905: 86%, ENSRNOG00000007647: 86%
Entrez Gene ID: 4986
Uniprot ID: P41145
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDGMNKPV
Gene Sequence RCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDGMNKPV
Gene ID - Mouse ENSMUSG00000025905
Gene ID - Rat ENSRNOG00000007647
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OPRK1 pAb (ATL-HPA067549)
Datasheet Anti OPRK1 pAb (ATL-HPA067549) Datasheet (External Link)
Vendor Page Anti OPRK1 pAb (ATL-HPA067549) at Atlas Antibodies

Documents & Links for Anti OPRK1 pAb (ATL-HPA067549)
Datasheet Anti OPRK1 pAb (ATL-HPA067549) Datasheet (External Link)
Vendor Page Anti OPRK1 pAb (ATL-HPA067549)