Anti OPLAH pAb (ATL-HPA052429)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052429-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: OPLAH
Alternative Gene Name: 5-Opase, OPLA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022562: 89%, ENSRNOG00000011781: 91%
Entrez Gene ID: 26873
Uniprot ID: O14841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QANAELAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQGSAVFDFSGTGPEVFGNLNA |
| Gene Sequence | QANAELAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQGSAVFDFSGTGPEVFGNLNA |
| Gene ID - Mouse | ENSMUSG00000022562 |
| Gene ID - Rat | ENSRNOG00000011781 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OPLAH pAb (ATL-HPA052429) | |
| Datasheet | Anti OPLAH pAb (ATL-HPA052429) Datasheet (External Link) |
| Vendor Page | Anti OPLAH pAb (ATL-HPA052429) at Atlas Antibodies |
| Documents & Links for Anti OPLAH pAb (ATL-HPA052429) | |
| Datasheet | Anti OPLAH pAb (ATL-HPA052429) Datasheet (External Link) |
| Vendor Page | Anti OPLAH pAb (ATL-HPA052429) |