Anti OMG pAb (ATL-HPA008206 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008206-25

Protein Description: oligodendrocyte myelin glycoprotein
Gene Name: OMG
Alternative Gene Name: OMGP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049612: 79%, ENSRNOG00000014107: 81%
Entrez Gene ID: 4974
Uniprot ID: P23515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVANAWKVNA
• Gene Sequence: VDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVANAWKVNA
• Gene ID - Mouse: ENSMUSG00000049612
• Gene ID - Rat: ENSRNOG00000014107
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OMG pAb (ATL-HPA008206 w/enhanced validation) – 2 Found

Remnestål, Julia; Öijerstedt, Linn; Ullgren, Abbe; Olofsson, Jennie; Bergström, Sofia; Kultima, Kim; Ingelsson, Martin; Kilander, Lena; Uhlén, Mathias; Månberg, Anna; Graff, Caroline; Nilsson, Peter. Altered levels of CSF proteins in patients with FTD, presymptomatic mutation carriers and non-carriers. Translational Neurodegeneration. 2020;9(1):27. 

Remnestål, Julia; Bergström, Sofia; Olofsson, Jennie; Sjöstedt, Evelina; Uhlén, Mathias; Blennow, Kaj; Zetterberg, Henrik; Zettergren, Anna; Kern, Silke; Skoog, Ingmar; Nilsson, Peter; Månberg, Anna. Association of CSF proteins with tau and amyloid β levels in asymptomatic 70-year-olds. Alzheimer's Research & Therapy. 2021;13(1):54.