Anti OMD pAb (ATL-HPA069948)

Atlas Antibodies

Catalog No.:
ATL-HPA069948-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: osteomodulin
Gene Name: OMD
Alternative Gene Name: osteoadherin, SLRR2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048368: 85%, ENSRNOG00000039560: 86%
Entrez Gene ID: 4958
Uniprot ID: Q99983
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIP
Gene Sequence PGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIP
Gene ID - Mouse ENSMUSG00000048368
Gene ID - Rat ENSRNOG00000039560
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OMD pAb (ATL-HPA069948)
Datasheet Anti OMD pAb (ATL-HPA069948) Datasheet (External Link)
Vendor Page Anti OMD pAb (ATL-HPA069948) at Atlas Antibodies

Documents & Links for Anti OMD pAb (ATL-HPA069948)
Datasheet Anti OMD pAb (ATL-HPA069948) Datasheet (External Link)
Vendor Page Anti OMD pAb (ATL-HPA069948)