Anti OMA1 pAb (ATL-HPA055120)

Atlas Antibodies

Catalog No.:
ATL-HPA055120-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: OMA1 zinc metallopeptidase
Gene Name: OMA1
Alternative Gene Name: FLJ33782, MPRP-1, YKR087C, ZMPOMA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035069: 79%, ENSRNOG00000007214: 79%
Entrez Gene ID: 115209
Uniprot ID: Q96E52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS
Gene Sequence YLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS
Gene ID - Mouse ENSMUSG00000035069
Gene ID - Rat ENSRNOG00000007214
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OMA1 pAb (ATL-HPA055120)
Datasheet Anti OMA1 pAb (ATL-HPA055120) Datasheet (External Link)
Vendor Page Anti OMA1 pAb (ATL-HPA055120) at Atlas Antibodies

Documents & Links for Anti OMA1 pAb (ATL-HPA055120)
Datasheet Anti OMA1 pAb (ATL-HPA055120) Datasheet (External Link)
Vendor Page Anti OMA1 pAb (ATL-HPA055120)