Anti OMA1 pAb (ATL-HPA055120)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055120-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: OMA1
Alternative Gene Name: FLJ33782, MPRP-1, YKR087C, ZMPOMA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035069: 79%, ENSRNOG00000007214: 79%
Entrez Gene ID: 115209
Uniprot ID: Q96E52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS |
Gene Sequence | YLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS |
Gene ID - Mouse | ENSMUSG00000035069 |
Gene ID - Rat | ENSRNOG00000007214 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti OMA1 pAb (ATL-HPA055120) | |
Datasheet | Anti OMA1 pAb (ATL-HPA055120) Datasheet (External Link) |
Vendor Page | Anti OMA1 pAb (ATL-HPA055120) at Atlas Antibodies |
Documents & Links for Anti OMA1 pAb (ATL-HPA055120) | |
Datasheet | Anti OMA1 pAb (ATL-HPA055120) Datasheet (External Link) |
Vendor Page | Anti OMA1 pAb (ATL-HPA055120) |