Anti OGFOD1 pAb (ATL-HPA003215)

Atlas Antibodies

Catalog No.: ATL-HPA003215-25

Protein Description: 2-oxoglutarate and iron-dependent oxygenase domain containing 1
Gene Name: OGFOD1
Alternative Gene Name: FLJ10826, KIAA1612, TPA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033009: 80%, ENSRNOG00000019288: 81%
Entrez Gene ID: 55239
Uniprot ID: Q8N543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPENNQMAISNNSQQSNEQTDPEPEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSF
• Gene Sequence: EPENNQMAISNNSQQSNEQTDPEPEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSF
• Gene ID - Mouse: ENSMUSG00000033009
• Gene ID - Rat: ENSRNOG00000019288
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OGFOD1 pAb (ATL-HPA003215) – 5 Found

Paolini, Nahuel A; Attwood, Martin; Sondalle, Samuel B; Vieira, Carolina Marques Dos Santos; van Adrichem, Anita M; di Summa, Franca M; O'Donohue, Marie-Françoise; Gleizes, Pierre-Emmanuel; Rachuri, Swaksha; Briggs, Joseph W; Fischer, Roman; Ratcliffe, Peter J; Wlodarski, Marcin W; Houtkooper, Riekelt H; von Lindern, Marieke; Kuijpers, Taco W; Dinman, Jonathan D; Baserga, Susan J; Cockman, Matthew E; MacInnes, Alyson W. A Ribosomopathy Reveals Decoding Defective Ribosomes Driving Human Dysmorphism. American Journal Of Human Genetics. 2017;100(3):506-522. 

Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. 

Wehner, Karen A; Schütz, Sylvia; Sarnow, Peter. OGFOD1, a novel modulator of eukaryotic translation initiation factor 2alpha phosphorylation and the cellular response to stress. Molecular And Cellular Biology. 2010;30(8):2006-16. 

Loenarz, Christoph; Sekirnik, Rok; Thalhammer, Armin; Ge, Wei; Spivakovsky, Ekaterina; Mackeen, Mukram M; McDonough, Michael A; Cockman, Matthew E; Kessler, Benedikt M; Ratcliffe, Peter J; Wolf, Alexander; Schofield, Christopher J. Hydroxylation of the eukaryotic ribosomal decoding center affects translational accuracy. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2014;111(11):4019-24. 

Kim, Jae-Hwan; Lee, Soon-Min; Lee, Jong-Hyuk; Chun, Sohyun; Kang, Byung-Hee; Kwak, Sojung; Roe, Jae-Seok; Kim, Tae Wan; Kim, Hyunsoo; Kim, Woo Ho; Cho, Eun-Jung; Youn, Hong-Duk. OGFOD1 is required for breast cancer cell proliferation and is associated with poor prognosis in breast cancer. Oncotarget. 2015;6(23):19528-41.