Anti OFCC1 pAb (ATL-HPA050619)

Atlas Antibodies

Catalog No.:
ATL-HPA050619-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: orofacial cleft 1 candidate 1
Gene Name: OFCC1
Alternative Gene Name: MRDS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047094: 57%, ENSRNOG00000024499: 63%
Entrez Gene ID: 107983965
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVKGKSTVWRIGEAEDYSQDISYLEELEEHRFSVCCSSVADSRYGDFFKHLHFVLVSASSELQLSQW
Gene Sequence SVKGKSTVWRIGEAEDYSQDISYLEELEEHRFSVCCSSVADSRYGDFFKHLHFVLVSASSELQLSQW
Gene ID - Mouse ENSMUSG00000047094
Gene ID - Rat ENSRNOG00000024499
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OFCC1 pAb (ATL-HPA050619)
Datasheet Anti OFCC1 pAb (ATL-HPA050619) Datasheet (External Link)
Vendor Page Anti OFCC1 pAb (ATL-HPA050619) at Atlas Antibodies

Documents & Links for Anti OFCC1 pAb (ATL-HPA050619)
Datasheet Anti OFCC1 pAb (ATL-HPA050619) Datasheet (External Link)
Vendor Page Anti OFCC1 pAb (ATL-HPA050619)