Anti ODF3L2 pAb (ATL-HPA067973)

Atlas Antibodies

Catalog No.:
ATL-HPA067973-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: outer dense fiber of sperm tails 3-like 2
Gene Name: ODF3L2
Alternative Gene Name: C19orf19, FLJ40059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035963: 87%, ENSRNOG00000008199: 85%
Entrez Gene ID: 284451
Uniprot ID: Q3SX64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VASPAYSLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEVTPGP
Gene Sequence VASPAYSLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEVTPGP
Gene ID - Mouse ENSMUSG00000035963
Gene ID - Rat ENSRNOG00000008199
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ODF3L2 pAb (ATL-HPA067973)
Datasheet Anti ODF3L2 pAb (ATL-HPA067973) Datasheet (External Link)
Vendor Page Anti ODF3L2 pAb (ATL-HPA067973) at Atlas Antibodies

Documents & Links for Anti ODF3L2 pAb (ATL-HPA067973)
Datasheet Anti ODF3L2 pAb (ATL-HPA067973) Datasheet (External Link)
Vendor Page Anti ODF3L2 pAb (ATL-HPA067973)