Anti ODF3L2 pAb (ATL-HPA067973)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067973-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ODF3L2
Alternative Gene Name: C19orf19, FLJ40059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035963: 87%, ENSRNOG00000008199: 85%
Entrez Gene ID: 284451
Uniprot ID: Q3SX64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VASPAYSLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEVTPGP |
| Gene Sequence | VASPAYSLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEVTPGP |
| Gene ID - Mouse | ENSMUSG00000035963 |
| Gene ID - Rat | ENSRNOG00000008199 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ODF3L2 pAb (ATL-HPA067973) | |
| Datasheet | Anti ODF3L2 pAb (ATL-HPA067973) Datasheet (External Link) |
| Vendor Page | Anti ODF3L2 pAb (ATL-HPA067973) at Atlas Antibodies |
| Documents & Links for Anti ODF3L2 pAb (ATL-HPA067973) | |
| Datasheet | Anti ODF3L2 pAb (ATL-HPA067973) Datasheet (External Link) |
| Vendor Page | Anti ODF3L2 pAb (ATL-HPA067973) |