Anti ODF3L2 pAb (ATL-HPA067973)

Atlas Antibodies

Catalog No.: ATL-HPA067973-25

Protein Description: outer dense fiber of sperm tails 3-like 2
Gene Name: ODF3L2
Alternative Gene Name: C19orf19, FLJ40059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035963: 87%, ENSRNOG00000008199: 85%
Entrez Gene ID: 284451
Uniprot ID: Q3SX64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VASPAYSLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEVTPGP
• Gene Sequence: VASPAYSLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEVTPGP
• Gene ID - Mouse: ENSMUSG00000035963
• Gene ID - Rat: ENSRNOG00000008199
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.