Anti ODF2L pAb (ATL-HPA028095)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028095-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ODF2L
Alternative Gene Name: KIAA1229
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028256: 79%, ENSRNOG00000014059: 74%
Entrez Gene ID: 57489
Uniprot ID: Q9ULJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SVKVVHERLQIQIHKREAENDKLKEYVKSLETKIAKWNLQSRMNKNEAIVMKEASRQKTVALKKASKVYKQRLDHFTGAIE |
| Gene Sequence | SVKVVHERLQIQIHKREAENDKLKEYVKSLETKIAKWNLQSRMNKNEAIVMKEASRQKTVALKKASKVYKQRLDHFTGAIE |
| Gene ID - Mouse | ENSMUSG00000028256 |
| Gene ID - Rat | ENSRNOG00000014059 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ODF2L pAb (ATL-HPA028095) | |
| Datasheet | Anti ODF2L pAb (ATL-HPA028095) Datasheet (External Link) |
| Vendor Page | Anti ODF2L pAb (ATL-HPA028095) at Atlas Antibodies |
| Documents & Links for Anti ODF2L pAb (ATL-HPA028095) | |
| Datasheet | Anti ODF2L pAb (ATL-HPA028095) Datasheet (External Link) |
| Vendor Page | Anti ODF2L pAb (ATL-HPA028095) |