Anti ODAM pAb (ATL-HPA070297)

Atlas Antibodies

Catalog No.:
ATL-HPA070297-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: odontogenic, ameloblast associated
Gene Name: ODAM
Alternative Gene Name: APin, FLJ20513
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009580: 67%, ENSRNOG00000023372: 68%
Entrez Gene ID: 54959
Uniprot ID: A1E959
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGY
Gene Sequence PLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGY
Gene ID - Mouse ENSMUSG00000009580
Gene ID - Rat ENSRNOG00000023372
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ODAM pAb (ATL-HPA070297)
Datasheet Anti ODAM pAb (ATL-HPA070297) Datasheet (External Link)
Vendor Page Anti ODAM pAb (ATL-HPA070297) at Atlas Antibodies

Documents & Links for Anti ODAM pAb (ATL-HPA070297)
Datasheet Anti ODAM pAb (ATL-HPA070297) Datasheet (External Link)
Vendor Page Anti ODAM pAb (ATL-HPA070297)