Anti OCM2 pAb (ATL-HPA052483)

Atlas Antibodies

Catalog No.:
ATL-HPA052483-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: oncomodulin 2
Gene Name: OCM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029618: 83%, ENSRNOG00000001031: 87%
Entrez Gene ID: 4951
Uniprot ID: P0CE71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDG
Gene Sequence ASQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDG
Gene ID - Mouse ENSMUSG00000029618
Gene ID - Rat ENSRNOG00000001031
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OCM2 pAb (ATL-HPA052483)
Datasheet Anti OCM2 pAb (ATL-HPA052483) Datasheet (External Link)
Vendor Page Anti OCM2 pAb (ATL-HPA052483) at Atlas Antibodies

Documents & Links for Anti OCM2 pAb (ATL-HPA052483)
Datasheet Anti OCM2 pAb (ATL-HPA052483) Datasheet (External Link)
Vendor Page Anti OCM2 pAb (ATL-HPA052483)