Anti OCM pAb (ATL-HPA046422)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046422-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: OCM
Alternative Gene Name: OCM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029618: 95%, ENSRNOG00000001031: 93%
Entrez Gene ID: 654231
Uniprot ID: P0CE72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA |
Gene Sequence | MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA |
Gene ID - Mouse | ENSMUSG00000029618 |
Gene ID - Rat | ENSRNOG00000001031 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti OCM pAb (ATL-HPA046422) | |
Datasheet | Anti OCM pAb (ATL-HPA046422) Datasheet (External Link) |
Vendor Page | Anti OCM pAb (ATL-HPA046422) at Atlas Antibodies |
Documents & Links for Anti OCM pAb (ATL-HPA046422) | |
Datasheet | Anti OCM pAb (ATL-HPA046422) Datasheet (External Link) |
Vendor Page | Anti OCM pAb (ATL-HPA046422) |