Anti OCM pAb (ATL-HPA046422)

Atlas Antibodies

Catalog No.:
ATL-HPA046422-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: oncomodulin
Gene Name: OCM
Alternative Gene Name: OCM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029618: 95%, ENSRNOG00000001031: 93%
Entrez Gene ID: 654231
Uniprot ID: P0CE72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA
Gene Sequence MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA
Gene ID - Mouse ENSMUSG00000029618
Gene ID - Rat ENSRNOG00000001031
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OCM pAb (ATL-HPA046422)
Datasheet Anti OCM pAb (ATL-HPA046422) Datasheet (External Link)
Vendor Page Anti OCM pAb (ATL-HPA046422) at Atlas Antibodies

Documents & Links for Anti OCM pAb (ATL-HPA046422)
Datasheet Anti OCM pAb (ATL-HPA046422) Datasheet (External Link)
Vendor Page Anti OCM pAb (ATL-HPA046422)