Anti OBP2A pAb (ATL-HPA055955)

Atlas Antibodies

Catalog No.:
ATL-HPA055955-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: odorant binding protein 2A
Gene Name: OBP2A
Alternative Gene Name: hOBPIIa, LCN13, OBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001158: 29%, ENSRNOG00000017045: 31%
Entrez Gene ID: 29991
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNWCSTRDSRRRTFSRPCRREAAFSNTRQPPGLHLQSPPYHQTQSPDHLDLPSSHDPSLLPP
Gene Sequence RNWCSTRDSRRRTFSRPCRREAAFSNTRQPPGLHLQSPPYHQTQSPDHLDLPSSHDPSLLPP
Gene ID - Mouse ENSMUSG00000001158
Gene ID - Rat ENSRNOG00000017045
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OBP2A pAb (ATL-HPA055955)
Datasheet Anti OBP2A pAb (ATL-HPA055955) Datasheet (External Link)
Vendor Page Anti OBP2A pAb (ATL-HPA055955) at Atlas Antibodies

Documents & Links for Anti OBP2A pAb (ATL-HPA055955)
Datasheet Anti OBP2A pAb (ATL-HPA055955) Datasheet (External Link)
Vendor Page Anti OBP2A pAb (ATL-HPA055955)