Anti OBP2A pAb (ATL-HPA055955)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055955-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: OBP2A
Alternative Gene Name: hOBPIIa, LCN13, OBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001158: 29%, ENSRNOG00000017045: 31%
Entrez Gene ID: 29991
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RNWCSTRDSRRRTFSRPCRREAAFSNTRQPPGLHLQSPPYHQTQSPDHLDLPSSHDPSLLPP |
| Gene Sequence | RNWCSTRDSRRRTFSRPCRREAAFSNTRQPPGLHLQSPPYHQTQSPDHLDLPSSHDPSLLPP |
| Gene ID - Mouse | ENSMUSG00000001158 |
| Gene ID - Rat | ENSRNOG00000017045 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OBP2A pAb (ATL-HPA055955) | |
| Datasheet | Anti OBP2A pAb (ATL-HPA055955) Datasheet (External Link) |
| Vendor Page | Anti OBP2A pAb (ATL-HPA055955) at Atlas Antibodies |
| Documents & Links for Anti OBP2A pAb (ATL-HPA055955) | |
| Datasheet | Anti OBP2A pAb (ATL-HPA055955) Datasheet (External Link) |
| Vendor Page | Anti OBP2A pAb (ATL-HPA055955) |