Anti OBP2A pAb (ATL-HPA055955)

Atlas Antibodies

Catalog No.: ATL-HPA055955-25

Protein Description: odorant binding protein 2A
Gene Name: OBP2A
Alternative Gene Name: hOBPIIa, LCN13, OBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001158: 29%, ENSRNOG00000017045: 31%
Entrez Gene ID: 29991
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RNWCSTRDSRRRTFSRPCRREAAFSNTRQPPGLHLQSPPYHQTQSPDHLDLPSSHDPSLLPP
• Gene Sequence: RNWCSTRDSRRRTFSRPCRREAAFSNTRQPPGLHLQSPPYHQTQSPDHLDLPSSHDPSLLPP
• Gene ID - Mouse: ENSMUSG00000001158
• Gene ID - Rat: ENSRNOG00000017045
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.