Anti OBP2A pAb (ATL-HPA055955)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055955-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: OBP2A
Alternative Gene Name: hOBPIIa, LCN13, OBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001158: 29%, ENSRNOG00000017045: 31%
Entrez Gene ID: 29991
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RNWCSTRDSRRRTFSRPCRREAAFSNTRQPPGLHLQSPPYHQTQSPDHLDLPSSHDPSLLPP |
Gene Sequence | RNWCSTRDSRRRTFSRPCRREAAFSNTRQPPGLHLQSPPYHQTQSPDHLDLPSSHDPSLLPP |
Gene ID - Mouse | ENSMUSG00000001158 |
Gene ID - Rat | ENSRNOG00000017045 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti OBP2A pAb (ATL-HPA055955) | |
Datasheet | Anti OBP2A pAb (ATL-HPA055955) Datasheet (External Link) |
Vendor Page | Anti OBP2A pAb (ATL-HPA055955) at Atlas Antibodies |
Documents & Links for Anti OBP2A pAb (ATL-HPA055955) | |
Datasheet | Anti OBP2A pAb (ATL-HPA055955) Datasheet (External Link) |
Vendor Page | Anti OBP2A pAb (ATL-HPA055955) |