Anti OAT pAb (ATL-HPA064742)

Atlas Antibodies

Catalog No.:
ATL-HPA064742-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ornithine aminotransferase
Gene Name: OAT
Alternative Gene Name: HOGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030934: 95%, ENSRNOG00000016807: 97%
Entrez Gene ID: 4942
Uniprot ID: P04181
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGST
Gene Sequence GYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGST
Gene ID - Mouse ENSMUSG00000030934
Gene ID - Rat ENSRNOG00000016807
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OAT pAb (ATL-HPA064742)
Datasheet Anti OAT pAb (ATL-HPA064742) Datasheet (External Link)
Vendor Page Anti OAT pAb (ATL-HPA064742) at Atlas Antibodies

Documents & Links for Anti OAT pAb (ATL-HPA064742)
Datasheet Anti OAT pAb (ATL-HPA064742) Datasheet (External Link)
Vendor Page Anti OAT pAb (ATL-HPA064742)