Anti OAS3 pAb (ATL-HPA041253)

Atlas Antibodies

Catalog No.: ATL-HPA041253-25

Protein Description: 2'-5'-oligoadenylate synthetase 3, 100kDa
Gene Name: OAS3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032661: 58%, ENSRNOG00000059207: 58%
Entrez Gene ID: 4940
Uniprot ID: Q9Y6K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQV
• Gene Sequence: LKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQV
• Gene ID - Mouse: ENSMUSG00000032661
• Gene ID - Rat: ENSRNOG00000059207
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.