Anti OAS3 pAb (ATL-HPA041253)

Atlas Antibodies

Catalog No.:
ATL-HPA041253-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: 2'-5'-oligoadenylate synthetase 3, 100kDa
Gene Name: OAS3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032661: 58%, ENSRNOG00000059207: 58%
Entrez Gene ID: 4940
Uniprot ID: Q9Y6K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQV
Gene Sequence LKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQV
Gene ID - Mouse ENSMUSG00000032661
Gene ID - Rat ENSRNOG00000059207
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OAS3 pAb (ATL-HPA041253)
Datasheet Anti OAS3 pAb (ATL-HPA041253) Datasheet (External Link)
Vendor Page Anti OAS3 pAb (ATL-HPA041253) at Atlas Antibodies

Documents & Links for Anti OAS3 pAb (ATL-HPA041253)
Datasheet Anti OAS3 pAb (ATL-HPA041253) Datasheet (External Link)
Vendor Page Anti OAS3 pAb (ATL-HPA041253)