Anti NYAP2 pAb (ATL-HPA056945)

Atlas Antibodies

Catalog No.:
ATL-HPA056945-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 2
Gene Name: NYAP2
Alternative Gene Name: KIAA1486
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054976: 92%, ENSRNOG00000023765: 91%
Entrez Gene ID: 57624
Uniprot ID: Q9P242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YDAVHSGSLSRSSPSVPHSTPRPVSQDGAKMVNAAVNTYGAAPGGSRSRTPTSPLEELTSLFSSGRSLLRKSSSG
Gene Sequence YDAVHSGSLSRSSPSVPHSTPRPVSQDGAKMVNAAVNTYGAAPGGSRSRTPTSPLEELTSLFSSGRSLLRKSSSG
Gene ID - Mouse ENSMUSG00000054976
Gene ID - Rat ENSRNOG00000023765
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NYAP2 pAb (ATL-HPA056945)
Datasheet Anti NYAP2 pAb (ATL-HPA056945) Datasheet (External Link)
Vendor Page Anti NYAP2 pAb (ATL-HPA056945) at Atlas Antibodies

Documents & Links for Anti NYAP2 pAb (ATL-HPA056945)
Datasheet Anti NYAP2 pAb (ATL-HPA056945) Datasheet (External Link)
Vendor Page Anti NYAP2 pAb (ATL-HPA056945)