Anti NYAP2 pAb (ATL-HPA056945)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056945-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NYAP2
Alternative Gene Name: KIAA1486
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054976: 92%, ENSRNOG00000023765: 91%
Entrez Gene ID: 57624
Uniprot ID: Q9P242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YDAVHSGSLSRSSPSVPHSTPRPVSQDGAKMVNAAVNTYGAAPGGSRSRTPTSPLEELTSLFSSGRSLLRKSSSG |
| Gene Sequence | YDAVHSGSLSRSSPSVPHSTPRPVSQDGAKMVNAAVNTYGAAPGGSRSRTPTSPLEELTSLFSSGRSLLRKSSSG |
| Gene ID - Mouse | ENSMUSG00000054976 |
| Gene ID - Rat | ENSRNOG00000023765 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NYAP2 pAb (ATL-HPA056945) | |
| Datasheet | Anti NYAP2 pAb (ATL-HPA056945) Datasheet (External Link) |
| Vendor Page | Anti NYAP2 pAb (ATL-HPA056945) at Atlas Antibodies |
| Documents & Links for Anti NYAP2 pAb (ATL-HPA056945) | |
| Datasheet | Anti NYAP2 pAb (ATL-HPA056945) Datasheet (External Link) |
| Vendor Page | Anti NYAP2 pAb (ATL-HPA056945) |