Anti NXPH3 pAb (ATL-HPA073819)

Atlas Antibodies

Catalog No.:
ATL-HPA073819-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: neurexophilin 3
Gene Name: NXPH3
Alternative Gene Name: NPH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046719: 90%, ENSRNOG00000005185: 92%
Entrez Gene ID: 11248
Uniprot ID: O95157
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPPGSEDPERDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPNRPNH
Gene Sequence GPPGSEDPERDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPNRPNH
Gene ID - Mouse ENSMUSG00000046719
Gene ID - Rat ENSRNOG00000005185
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NXPH3 pAb (ATL-HPA073819)
Datasheet Anti NXPH3 pAb (ATL-HPA073819) Datasheet (External Link)
Vendor Page Anti NXPH3 pAb (ATL-HPA073819) at Atlas Antibodies

Documents & Links for Anti NXPH3 pAb (ATL-HPA073819)
Datasheet Anti NXPH3 pAb (ATL-HPA073819) Datasheet (External Link)
Vendor Page Anti NXPH3 pAb (ATL-HPA073819)