Anti NWD1 pAb (ATL-HPA075476)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075476-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NWD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048148: 73%, ENSRNOG00000052129: 76%
Entrez Gene ID: 284434
Uniprot ID: Q149M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATVFLREIQDLHKHILEDCALRMVDRLADGCLDTDAQNLLSSLKSHITDMHPGVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLT |
Gene Sequence | ATVFLREIQDLHKHILEDCALRMVDRLADGCLDTDAQNLLSSLKSHITDMHPGVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLT |
Gene ID - Mouse | ENSMUSG00000048148 |
Gene ID - Rat | ENSRNOG00000052129 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NWD1 pAb (ATL-HPA075476) | |
Datasheet | Anti NWD1 pAb (ATL-HPA075476) Datasheet (External Link) |
Vendor Page | Anti NWD1 pAb (ATL-HPA075476) at Atlas Antibodies |
Documents & Links for Anti NWD1 pAb (ATL-HPA075476) | |
Datasheet | Anti NWD1 pAb (ATL-HPA075476) Datasheet (External Link) |
Vendor Page | Anti NWD1 pAb (ATL-HPA075476) |