Anti NVL pAb (ATL-HPA028224)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028224-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: NVL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026516: 89%, ENSRNOG00000003629: 79%
Entrez Gene ID: 4931
Uniprot ID: O15381
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDPLSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPN |
| Gene Sequence | VNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDPLSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPN |
| Gene ID - Mouse | ENSMUSG00000026516 |
| Gene ID - Rat | ENSRNOG00000003629 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NVL pAb (ATL-HPA028224) | |
| Datasheet | Anti NVL pAb (ATL-HPA028224) Datasheet (External Link) |
| Vendor Page | Anti NVL pAb (ATL-HPA028224) at Atlas Antibodies |
| Documents & Links for Anti NVL pAb (ATL-HPA028224) | |
| Datasheet | Anti NVL pAb (ATL-HPA028224) Datasheet (External Link) |
| Vendor Page | Anti NVL pAb (ATL-HPA028224) |