Anti NVL pAb (ATL-HPA028224)

Atlas Antibodies

Catalog No.:
ATL-HPA028224-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: nuclear VCP-like
Gene Name: NVL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026516: 89%, ENSRNOG00000003629: 79%
Entrez Gene ID: 4931
Uniprot ID: O15381
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDPLSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPN
Gene Sequence VNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDPLSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPN
Gene ID - Mouse ENSMUSG00000026516
Gene ID - Rat ENSRNOG00000003629
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NVL pAb (ATL-HPA028224)
Datasheet Anti NVL pAb (ATL-HPA028224) Datasheet (External Link)
Vendor Page Anti NVL pAb (ATL-HPA028224) at Atlas Antibodies

Documents & Links for Anti NVL pAb (ATL-HPA028224)
Datasheet Anti NVL pAb (ATL-HPA028224) Datasheet (External Link)
Vendor Page Anti NVL pAb (ATL-HPA028224)