Anti NUSAP1 pAb (ATL-HPA074847)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074847-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NUSAP1
Alternative Gene Name: ANKT, BM037, FLJ13421, LNP, NuSAP1, PRO0310p1, Q0310, SAPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027306: 76%, ENSRNOG00000004921: 76%
Entrez Gene ID: 51203
Uniprot ID: Q9BXS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | THKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ |
Gene Sequence | THKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ |
Gene ID - Mouse | ENSMUSG00000027306 |
Gene ID - Rat | ENSRNOG00000004921 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NUSAP1 pAb (ATL-HPA074847) | |
Datasheet | Anti NUSAP1 pAb (ATL-HPA074847) Datasheet (External Link) |
Vendor Page | Anti NUSAP1 pAb (ATL-HPA074847) at Atlas Antibodies |
Documents & Links for Anti NUSAP1 pAb (ATL-HPA074847) | |
Datasheet | Anti NUSAP1 pAb (ATL-HPA074847) Datasheet (External Link) |
Vendor Page | Anti NUSAP1 pAb (ATL-HPA074847) |