Anti NUSAP1 pAb (ATL-HPA074847)

Atlas Antibodies

Catalog No.:
ATL-HPA074847-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nucleolar and spindle associated protein 1
Gene Name: NUSAP1
Alternative Gene Name: ANKT, BM037, FLJ13421, LNP, NuSAP1, PRO0310p1, Q0310, SAPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027306: 76%, ENSRNOG00000004921: 76%
Entrez Gene ID: 51203
Uniprot ID: Q9BXS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen THKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ
Gene Sequence THKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ
Gene ID - Mouse ENSMUSG00000027306
Gene ID - Rat ENSRNOG00000004921
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUSAP1 pAb (ATL-HPA074847)
Datasheet Anti NUSAP1 pAb (ATL-HPA074847) Datasheet (External Link)
Vendor Page Anti NUSAP1 pAb (ATL-HPA074847) at Atlas Antibodies

Documents & Links for Anti NUSAP1 pAb (ATL-HPA074847)
Datasheet Anti NUSAP1 pAb (ATL-HPA074847) Datasheet (External Link)
Vendor Page Anti NUSAP1 pAb (ATL-HPA074847)