Anti NUSAP1 pAb (ATL-HPA074847)

Atlas Antibodies

Catalog No.: ATL-HPA074847-25

Protein Description: nucleolar and spindle associated protein 1
Gene Name: NUSAP1
Alternative Gene Name: ANKT, BM037, FLJ13421, LNP, NuSAP1, PRO0310p1, Q0310, SAPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027306: 76%, ENSRNOG00000004921: 76%
Entrez Gene ID: 51203
Uniprot ID: Q9BXS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: THKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ
• Gene Sequence: THKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ
• Gene ID - Mouse: ENSMUSG00000027306
• Gene ID - Rat: ENSRNOG00000004921
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.