Anti NUP85 pAb (ATL-HPA061910)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061910-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NUP85
Alternative Gene Name: FLJ12549, NUP75
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020739: 83%, ENSRNOG00000003673: 89%
Entrez Gene ID: 79902
Uniprot ID: Q9BW27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ |
Gene Sequence | ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ |
Gene ID - Mouse | ENSMUSG00000020739 |
Gene ID - Rat | ENSRNOG00000003673 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NUP85 pAb (ATL-HPA061910) | |
Datasheet | Anti NUP85 pAb (ATL-HPA061910) Datasheet (External Link) |
Vendor Page | Anti NUP85 pAb (ATL-HPA061910) at Atlas Antibodies |
Documents & Links for Anti NUP85 pAb (ATL-HPA061910) | |
Datasheet | Anti NUP85 pAb (ATL-HPA061910) Datasheet (External Link) |
Vendor Page | Anti NUP85 pAb (ATL-HPA061910) |