Anti NUP85 pAb (ATL-HPA061910)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061910-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NUP85
Alternative Gene Name: FLJ12549, NUP75
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020739: 83%, ENSRNOG00000003673: 89%
Entrez Gene ID: 79902
Uniprot ID: Q9BW27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ |
| Gene Sequence | ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ |
| Gene ID - Mouse | ENSMUSG00000020739 |
| Gene ID - Rat | ENSRNOG00000003673 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NUP85 pAb (ATL-HPA061910) | |
| Datasheet | Anti NUP85 pAb (ATL-HPA061910) Datasheet (External Link) |
| Vendor Page | Anti NUP85 pAb (ATL-HPA061910) at Atlas Antibodies |
| Documents & Links for Anti NUP85 pAb (ATL-HPA061910) | |
| Datasheet | Anti NUP85 pAb (ATL-HPA061910) Datasheet (External Link) |
| Vendor Page | Anti NUP85 pAb (ATL-HPA061910) |