Anti NUP50 pAb (ATL-HPA047162 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA047162-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nucleoporin 50kDa
Gene Name: NUP50
Alternative Gene Name: NPAP60L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016619: 76%, ENSRNOG00000013423: 71%
Entrez Gene ID: 10762
Uniprot ID: Q9UKX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSQQPSSSGLASSKACVGNAYHKQLAALDCSVRD
Gene Sequence DSQQPSSSGLASSKACVGNAYHKQLAALDCSVRD
Gene ID - Mouse ENSMUSG00000016619
Gene ID - Rat ENSRNOG00000013423
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUP50 pAb (ATL-HPA047162 w/enhanced validation)
Datasheet Anti NUP50 pAb (ATL-HPA047162 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NUP50 pAb (ATL-HPA047162 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NUP50 pAb (ATL-HPA047162 w/enhanced validation)
Datasheet Anti NUP50 pAb (ATL-HPA047162 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NUP50 pAb (ATL-HPA047162 w/enhanced validation)