Anti NUP43 pAb (ATL-HPA028500 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA028500-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nucleoporin 43kDa
Gene Name: NUP43
Alternative Gene Name: bA350J20.1, FLJ13287
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040034: 92%, ENSRNOG00000049505: 90%
Entrez Gene ID: 348995
Uniprot ID: Q8NFH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGMEEIYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIGDFGNLDSDGGFEGDHQLLCDIRHHGDVMDLQF
Gene Sequence FGMEEIYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIGDFGNLDSDGGFEGDHQLLCDIRHHGDVMDLQF
Gene ID - Mouse ENSMUSG00000040034
Gene ID - Rat ENSRNOG00000049505
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUP43 pAb (ATL-HPA028500 w/enhanced validation)
Datasheet Anti NUP43 pAb (ATL-HPA028500 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NUP43 pAb (ATL-HPA028500 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NUP43 pAb (ATL-HPA028500 w/enhanced validation)
Datasheet Anti NUP43 pAb (ATL-HPA028500 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NUP43 pAb (ATL-HPA028500 w/enhanced validation)