Anti NUP37 pAb (ATL-HPA073708 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA073708-100
  • Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-NUP37 antibody. Corresponding NUP37 RNA-seq data are presented for the same tissues.
  • Western blot analysis using Anti-NUP37 antibody HPA073708 (A) shows similar pattern to independent antibody HPA056300 (B).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: nucleoporin 37kDa
Gene Name: NUP37
Alternative Gene Name: FLJ22618, MGC5585
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035351: 91%, ENSRNOG00000004727: 91%
Entrez Gene ID: 79023
Uniprot ID: Q8NFH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHTDFINGLVFDPKEGQEIASVSDDHTCRIWNLEGVQ
Gene Sequence ETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHTDFINGLVFDPKEGQEIASVSDDHTCRIWNLEGVQ
Gene ID - Mouse ENSMUSG00000035351
Gene ID - Rat ENSRNOG00000004727
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NUP37 pAb (ATL-HPA073708 w/enhanced validation)
Datasheet Anti NUP37 pAb (ATL-HPA073708 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NUP37 pAb (ATL-HPA073708 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NUP37 pAb (ATL-HPA073708 w/enhanced validation)
Datasheet Anti NUP37 pAb (ATL-HPA073708 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NUP37 pAb (ATL-HPA073708 w/enhanced validation)