Anti NUP35 pAb (ATL-HPA018401)

Atlas Antibodies

Catalog No.:
ATL-HPA018401-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: nucleoporin 35kDa
Gene Name: NUP35
Alternative Gene Name: MP44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091900: 99%, ENSRNOG00000009290: 99%
Entrez Gene ID: 129401
Uniprot ID: Q8NFH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCID
Gene Sequence DDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCID
Gene ID - Mouse ENSMUSG00000091900
Gene ID - Rat ENSRNOG00000009290
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUP35 pAb (ATL-HPA018401)
Datasheet Anti NUP35 pAb (ATL-HPA018401) Datasheet (External Link)
Vendor Page Anti NUP35 pAb (ATL-HPA018401) at Atlas Antibodies

Documents & Links for Anti NUP35 pAb (ATL-HPA018401)
Datasheet Anti NUP35 pAb (ATL-HPA018401) Datasheet (External Link)
Vendor Page Anti NUP35 pAb (ATL-HPA018401)