Anti NUP210L pAb (ATL-HPA066707)

Atlas Antibodies

Catalog No.:
ATL-HPA066707-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nucleoporin 210kDa-like
Gene Name: NUP210L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027939: 78%, ENSRNOG00000055790: 78%
Entrez Gene ID: 91181
Uniprot ID: Q5VU65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YVCIIKVRPQSEELLQALSVADTSVYGWATLVSERSKNGMQRILIPFIPAFYINQSELVLSHKQDIGEIRVLGVDRVLRKLE
Gene Sequence YVCIIKVRPQSEELLQALSVADTSVYGWATLVSERSKNGMQRILIPFIPAFYINQSELVLSHKQDIGEIRVLGVDRVLRKLE
Gene ID - Mouse ENSMUSG00000027939
Gene ID - Rat ENSRNOG00000055790
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUP210L pAb (ATL-HPA066707)
Datasheet Anti NUP210L pAb (ATL-HPA066707) Datasheet (External Link)
Vendor Page Anti NUP210L pAb (ATL-HPA066707) at Atlas Antibodies

Documents & Links for Anti NUP210L pAb (ATL-HPA066707)
Datasheet Anti NUP210L pAb (ATL-HPA066707) Datasheet (External Link)
Vendor Page Anti NUP210L pAb (ATL-HPA066707)