Anti NUP188 pAb (ATL-HPA063942)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063942-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NUP188
Alternative Gene Name: KIAA0169
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052533: 96%, ENSRNOG00000025185: 96%
Entrez Gene ID: 23511
Uniprot ID: Q5SRE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | APMSVYACLGNDAAAIRDAFLTRLQSKIEDMRIKVMILEFLTVAVETQPGLIELFLNLEVKDGSDGSKEFSLGMWSCLHAVLELIDSQQQDR |
Gene Sequence | APMSVYACLGNDAAAIRDAFLTRLQSKIEDMRIKVMILEFLTVAVETQPGLIELFLNLEVKDGSDGSKEFSLGMWSCLHAVLELIDSQQQDR |
Gene ID - Mouse | ENSMUSG00000052533 |
Gene ID - Rat | ENSRNOG00000025185 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NUP188 pAb (ATL-HPA063942) | |
Datasheet | Anti NUP188 pAb (ATL-HPA063942) Datasheet (External Link) |
Vendor Page | Anti NUP188 pAb (ATL-HPA063942) at Atlas Antibodies |
Documents & Links for Anti NUP188 pAb (ATL-HPA063942) | |
Datasheet | Anti NUP188 pAb (ATL-HPA063942) Datasheet (External Link) |
Vendor Page | Anti NUP188 pAb (ATL-HPA063942) |