Anti NUP188 pAb (ATL-HPA061750)

Atlas Antibodies

SKU:
ATL-HPA061750-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nucleoporin 188kDa
Gene Name: NUP188
Alternative Gene Name: KIAA0169
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052533: 95%, ENSRNOG00000025185: 96%
Entrez Gene ID: 23511
Uniprot ID: Q5SRE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YFSALILVEGMDIESLHKCALDDRRELHQFAQDGLICQDMDCLMLTFGDIPHHAPVLLAWALLRHTLNPEETSSVVRKIGGTAIQLNVFQYLTRLLQSLASGGNDCTTSTACMCVYGLLS
Gene Sequence YFSALILVEGMDIESLHKCALDDRRELHQFAQDGLICQDMDCLMLTFGDIPHHAPVLLAWALLRHTLNPEETSSVVRKIGGTAIQLNVFQYLTRLLQSLASGGNDCTTSTACMCVYGLLS
Gene ID - Mouse ENSMUSG00000052533
Gene ID - Rat ENSRNOG00000025185
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NUP188 pAb (ATL-HPA061750)
Datasheet Anti NUP188 pAb (ATL-HPA061750) Datasheet (External Link)
Vendor Page Anti NUP188 pAb (ATL-HPA061750) at Atlas Antibodies

Documents & Links for Anti NUP188 pAb (ATL-HPA061750)
Datasheet Anti NUP188 pAb (ATL-HPA061750) Datasheet (External Link)
Vendor Page Anti NUP188 pAb (ATL-HPA061750)