Anti NUP133 pAb (ATL-HPA059767)

Atlas Antibodies

Catalog No.:
ATL-HPA059767-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: nucleoporin 133kDa
Gene Name: NUP133
Alternative Gene Name: FLJ10814
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039509: 84%, ENSRNOG00000017919: 83%
Entrez Gene ID: 55746
Uniprot ID: Q8WUM0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTQISVDLMDDYPASDPRWAESVPEEAPGFSNTSLIILHQLEDKMKAHSFLMDFIHQVGLFGRLGSFPVRGTPMATRLLLCEHAEKLSAAIVLKNHHSRLSDLVNTAILIALNKREYEIPSNLTPA
Gene Sequence VTQISVDLMDDYPASDPRWAESVPEEAPGFSNTSLIILHQLEDKMKAHSFLMDFIHQVGLFGRLGSFPVRGTPMATRLLLCEHAEKLSAAIVLKNHHSRLSDLVNTAILIALNKREYEIPSNLTPA
Gene ID - Mouse ENSMUSG00000039509
Gene ID - Rat ENSRNOG00000017919
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUP133 pAb (ATL-HPA059767)
Datasheet Anti NUP133 pAb (ATL-HPA059767) Datasheet (External Link)
Vendor Page Anti NUP133 pAb (ATL-HPA059767) at Atlas Antibodies

Documents & Links for Anti NUP133 pAb (ATL-HPA059767)
Datasheet Anti NUP133 pAb (ATL-HPA059767) Datasheet (External Link)
Vendor Page Anti NUP133 pAb (ATL-HPA059767)